PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof002664
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 284aa    MW: 30680.5 Da    PI: 9.7014
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-96539PU_refplantGDBView CDS
gnl|UG|Sof#S17299243PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.18.6e-131862347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+++++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
        Sof002664 18 AWTEEEHKKFLLGLNKLGKGDWRGISRNYVISRTPTQVASHAQKY 62
                     7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.5931167IPR017930Myb domain
SuperFamilySSF466892.69E-161268IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-181466IPR006447Myb domain, plants
SMARTSM007171.6E-101565IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-101764IPR009057Homeodomain-like
PfamPF002492.9E-111862IPR001005SANT/Myb domain
CDDcd001674.42E-91863No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
XGPVCLGRPT RPKKRGEAWT EEEHKKFLLG LNKLGKGDWR GISRNYVISR TPTQVASHAQ  60
KYFNRQTNVH RRKRRSSLFD MVIDDSSDQL PLSRSSSQEV EQQHLDDPQP VAALPAPVVS  120
PATVVPPSVP VEVPVSVPPP VQVPVPVSAP VVTSQPMEQD SVASSSSAGE AGAVMPGAMP  180
PYLYPMMIPP PYYHPAFVPV PCYGYVPFYY GPPGAGQAPH EVVKPVAVHS TAPLNVKDLY  240
NISELNLKGD SDANGGVPAS PLPXKPIGRP KRQSAFHGKR PTHG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.215860.0crown| inflorescence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972870.11e-158PREDICTED: transcription factor MYB1R1-like
TrEMBLK3YI791e-158K3YI79_SETIT; Uncharacterized protein
STRINGSi013948m1e-158(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-26MYB_related family protein